PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_12390V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 392aa    MW: 43035.8 Da    PI: 8.2416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_12390V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+eEd +l+ +++q+G+g+W+t +++ g+ R++k+c++rw +yl
  Pp3c14_12390V3.1.p 14 RGPWTPEEDAKLLACIAQHGTGSWRTLPKKAGLQRCGKSCRLRWTNYL 61
                        89********************************************97 PP

2Myb_DNA-binding513.2e-1668110246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         gr+T  E++l+v++++ lG++ W++Ia+ ++ gRt++++k++w++
  Pp3c14_12390V3.1.p  68 GRFTDHEEQLIVNLHAALGSR-WSLIAAQLP-GRTDNDVKNYWNT 110
                         8********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.716965IPR017930Myb domain
SuperFamilySSF466891.2E-2912108IPR009057Homeodomain-like
SMARTSM007175.3E-141363IPR001005SANT/Myb domain
PfamPF002492.5E-161461IPR001005SANT/Myb domain
CDDcd001671.03E-111661No hitNo description
Gene3DG3DSA:1.10.10.606.4E-2565116IPR009057Homeodomain-like
SMARTSM007171.5E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129419.44966116IPR017930Myb domain
PfamPF002491.0E-1368110IPR001005SANT/Myb domain
CDDcd001671.03E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGRAPCCEKD SVKRGPWTPE EDAKLLACIA QHGTGSWRTL PKKAGLQRCG KSCRLRWTNY  60
LRPDLKHGRF TDHEEQLIVN LHAALGSRWS LIAAQLPGRT DNDVKNYWNT RLKKKLCEMG  120
IDPITHKPIS QLLADLASSM ALPKGGEIAE AALGCFKDDM LNVLMRKRPD WQLDGSNVAL  180
SNTTHGFSVG RQSWDMIGSP RSCVSQPRSV ISSAYNPSVY DRSNPTVTNQ NLRVDAAVQK  240
IKYSLSRAVQ TKEMQRVGDA VMPREDSMSR NMAVINGRFY RGECGIPGAT SGGANCSIQN  300
VHFPCMAQTP YIPTDLMCDQ QETSSRSNCT ENQCANTHVP TSCEMEPWSP SPSGSSCSNS  360
SLVKGDVAGL EKVLNSDVFL WDFSELGSIM S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141167108B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S36_198V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.19e-90myb domain protein 103